PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA118G00053
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 461aa    MW: 50779.4 Da    PI: 8.784
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA118G00053genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.95.2e-14383432554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  +r++r++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+  e+ +
  AA118G00053 383 RRQKRMIKNRESAARSRARKQAYTLELEAEVAQLKELNEELQKKQVEIME 432
                  69*************************************99987655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-13379444IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.53381426IPR004827Basic-leucine zipper domain
PfamPF001701.1E-12383434IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-10383434No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-13383438No hitNo description
CDDcd147072.48E-25383435No hitNo description
PROSITE patternPS000360386401IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MGSRLNFKNF VSDEVINQKQ PPTVGNLPLA RQNSVFSLTF DEFQNTCGGI GKDFGSMNMD  60
ELLKNIWTAE ENQSMMNNNI NSFNNTSNVT NGSIGNTVIN SCNNGGLSVG VGGGEGCGLY  120
SGGNLQRQGS LTLPRPLSQK TVDDVWRELM KEDDIGTVGG VGGAYGGSSV PPRQQTLGEM  180
TLEEFLVRAG VVREESQPVD ARLNNSNGVF YGFGSNAGLE LPQNGFGVNQ LQDFTGTGVA  240
VRPNQLITQT QPTQMQQPQK VQQPQELIKQ PQQLMQKQDT TFPKQTTIAF SNTVDVENHA  300
PLAIQCQEVK PSIHGVRDHS MNNSLLQAVD FKTGVTVAAV SPGSQMSPDL TPKSAMDASL  360
SPVPYMFGRG RKTGAVLEKV IERRQKRMIK NRESAARSRA RKQAYTLELE AEVAQLKELN  420
EELQKKQVEI MEKQKRQLME PMRRPWGCKR QCLRRTLTGP W
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBMTransfer from AT4G34000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412286.10.0hypothetical protein EUTSA_v10025203mg
SwissprotQ9M7Q30.0AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLE4MY110.0E4MY11_EUTHA; mRNA, clone: RTFL01-30-J01
TrEMBLV4MBG20.0V4MBG2_EUTSA; Uncharacterized protein
STRINGAT4G34000.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.20.0abscisic acid responsive elements-binding factor 3